Description
Sermorelin Acetate UK: The Essential GHRH 1-29 Research Peptide
Buy Sermorelin Acetate UK researchers frequently utilize this 29-residue N-terminal fragment for its ability to mimic naturally occurring Growth Hormone-Releasing Hormone (GHRH).3 This synthetic peptide represents the shortest functional fragment of GHRH that retains full biological activity.4 Consequently, scientists identify it as a critical subject for investigating the pulsatile release of growth hormone from the anterior pituitary gland.
Furthermore, Peptide Source UK synthesizes this compound to exceed standard laboratory requirements. We guarantee a minimum purity of 99% for every batch to ensure reliable experimental outcomes. Because we prioritize chemical precision, we provide these vials strictly for in-vitro evaluation and laboratory research within the UK scientific community.
Technical Specifications for Sermorelin Acetate UK
Buy Sermorelin Acetate UK (CAS: 114466-38-5) functions by binding directly to the GHRH receptors. Specifically, its molecular structure allows for rapid stimulation of the somatotropic axis. As a result, it remains a highly effective subject for observing the pituitary gland’s response to hormonal triggers in laboratory models.
Molecular Formula: C_{149}H_{246}N_{44}O_{42}S \cdot C_2H_4O_2
Molecular Weight: 3417.9 Da (Acetate salt)
Purity: ≥99% (HPLC Verified)
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Observed Research Applications
In addition to diagnostic evaluation, researchers utilize Sermorelin Acetate to observe systemic metabolic signals. First, studies monitor how the peptide stimulates growth hormone gene transcription.10 Second, scientists evaluate the subsequent increase in Insulin-like Growth Factor 1 (IGF-1) levels. Finally, research teams track the potential impact on cellular regeneration and muscle tissue preservation. Overall, these mechanisms make it a versatile tool for age-related and metabolic syndrome research in the UK.
Purity and UK Lab Verification
Because accurate data requires absolute chemical integrity, we provide batch-specific HPLC and Mass Spectrometry (MS) reports. Moreover, our vacuum-sealed vials ensure the peptide remains stable during transit across the UK. Therefore, you can confirm the molecular mass and purity profile before you initiate your laboratory protocols.
Storage and Handling for Sermorelin Acetate UK
To maintain structural integrity, you must store Sermorelin Acetate at -20°C for long-term preservation.11 However, you may keep it at 2-8°C for short-term research phases. Importantly, you should avoid repeated freeze-thaw cycles. Always ensure the lyophilized powder reaches room temperature before you reconstitute it with bacteriostatic water.





