Description

GLP-1 UK: The Fundamental Incretin Research Peptide

Buy GLP-1 UK researchers frequently utilize this endogenous incretin hormone to study glucose-dependent insulin secretion. This synthetic version represents the biologically active form of Glucagon-Like Peptide-1 (7-36) amide. Consequently, scientists identify it as a critical tool for investigating the complex mechanisms of the “incretin effect” and its role in metabolic homeostasis.

Furthermore, Peptide Source UK synthesizes this peptide to exceed standard laboratory requirements. We guarantee a minimum purity of 99% for every batch. Because we uphold the highest scientific standards, we provide these vials strictly for in-vitro evaluation and laboratory research within the UK.

Technical Specifications for GLP-1 UK

Buy GLP-1 UK (7-36) amide (CAS: 107444-51-9) acts as a potent agonist for the GLP-1 receptor. Specifically, its molecular structure allows it to bind with high affinity to pancreatic $\beta$-cells. As a result, it remains a highly efficient subject for observing postprandial insulin responses in laboratory models.

• Molecular Formula: $C_{149}H_{226}N_{40}O_{45}$

• Molecular Weight: 3297.7 Da

• Purity: ≥99% (HPLC Verified)

• Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

Observed Research Applications

In addition to glycemic control, researchers utilize GLP-1 to observe various physiological signals. First, studies evaluate how the peptide delays gastric emptying in gastraintestinal models. Second, scientists monitor the promotion of satiety signals within the hypothalamus. Finally, research teams track the potential neuroprotective and cardioprotective effects of GLP-1 receptor activation. Overall, these varied applications make it the most widely studied incretin in the UK scientific community.

Purity and UK Lab Verification

Because chemical precision determines the validity of your data, we provide batch-specific HPLC and Mass Spectrometry (MS) reports. Moreover, our vacuum-sealed vials ensure the peptide remains stable during transit across the UK. Therefore, you can verify the molecular mass and purity profile before you initiate your analytical research.